A review of vitamin D deficiency and vitamin D receptor polymorphisms in endocrine-related disorders
The endocrine system is a complex network of glands that produce and release hormones that regulate various physiological processes. In the past few decades, the human skin has been identified as an important peripheral endocrine organ that is the main site for the synthesis of vitamin D through exp...
Saved in:
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
The Korean Pediatric Society
2025-01-01
|
| Series: | Clinical and Experimental Pediatrics |
| Subjects: | |
| Online Access: | http://www.e-cep.org/upload/pdf/cep-2024-00227.pdf |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1825206610242306048 |
|---|---|
| author | Nur Faten Hafizah Rosli Noor Shafina Mohd Nor Rose Adzrianee Adnan Siti Hamimah Sheikh Abdul Kadir |
| author_facet | Nur Faten Hafizah Rosli Noor Shafina Mohd Nor Rose Adzrianee Adnan Siti Hamimah Sheikh Abdul Kadir |
| author_sort | Nur Faten Hafizah Rosli |
| collection | DOAJ |
| description | The endocrine system is a complex network of glands that produce and release hormones that regulate various physiological processes. In the past few decades, the human skin has been identified as an important peripheral endocrine organ that is the main site for the synthesis of vitamin D through exposure to sunlight. Mutations in downstream vitamin D-related gene pathways are associated with disease development. The vitamin D receptor (VDR) gene, which regulates the pleiotropic effects of vitamin D, has been extensively studied in adult populations. Several studies have reported the prevalence of vitamin D deficiency in children and adolescents. With changes in socioeconomic status and lifestyle, vitamin D-deficient individuals are prone to developing the disease at a young age. However, geographical and racial differences affect the association between VDR gene polymorphisms and vitamin D endocrine disorders, explaining the nonconsensus effects of polymorphisms and their association with disease development across populations. In this review, we discuss the connection between the vitamin D endocrine system and polymorphisms in the gene encoding VDR in children and adolescents, focusing on its effects on growth, puberty, insulin resistance, and the immune system. |
| format | Article |
| id | doaj-art-0dc6e3b02ab443f2b2c26b475321bcdb |
| institution | Kabale University |
| issn | 2713-4148 |
| language | English |
| publishDate | 2025-01-01 |
| publisher | The Korean Pediatric Society |
| record_format | Article |
| series | Clinical and Experimental Pediatrics |
| spelling | doaj-art-0dc6e3b02ab443f2b2c26b475321bcdb2025-02-07T07:38:34ZengThe Korean Pediatric SocietyClinical and Experimental Pediatrics2713-41482025-01-01681305210.3345/cep.2024.0022720125555738A review of vitamin D deficiency and vitamin D receptor polymorphisms in endocrine-related disordersNur Faten Hafizah Rosli0Noor Shafina Mohd Nor1Rose Adzrianee Adnan2Siti Hamimah Sheikh Abdul Kadir3 Institute of Medical Molecular Biotechnology (IMMB), Faculty of Medicine, Universiti Teknologi MARA (UiTM), Cawangan Selangor, Kampus Sungai Buloh, Jalan Hospital, Sungai Buloh, Malaysia Institute of Medical Molecular Biotechnology (IMMB), Faculty of Medicine, Universiti Teknologi MARA (UiTM), Cawangan Selangor, Kampus Sungai Buloh, Jalan Hospital, Sungai Buloh, Malaysia Department of Pathology, Faculty of Medicine, Universiti Teknologi MARA (UiTM), Cawangan Selangor, Kampus Sungai Buloh, Jalan Hospital, Sungai Buloh, Malaysia Institute of Medical Molecular Biotechnology (IMMB), Faculty of Medicine, Universiti Teknologi MARA (UiTM), Cawangan Selangor, Kampus Sungai Buloh, Jalan Hospital, Sungai Buloh, MalaysiaThe endocrine system is a complex network of glands that produce and release hormones that regulate various physiological processes. In the past few decades, the human skin has been identified as an important peripheral endocrine organ that is the main site for the synthesis of vitamin D through exposure to sunlight. Mutations in downstream vitamin D-related gene pathways are associated with disease development. The vitamin D receptor (VDR) gene, which regulates the pleiotropic effects of vitamin D, has been extensively studied in adult populations. Several studies have reported the prevalence of vitamin D deficiency in children and adolescents. With changes in socioeconomic status and lifestyle, vitamin D-deficient individuals are prone to developing the disease at a young age. However, geographical and racial differences affect the association between VDR gene polymorphisms and vitamin D endocrine disorders, explaining the nonconsensus effects of polymorphisms and their association with disease development across populations. In this review, we discuss the connection between the vitamin D endocrine system and polymorphisms in the gene encoding VDR in children and adolescents, focusing on its effects on growth, puberty, insulin resistance, and the immune system.http://www.e-cep.org/upload/pdf/cep-2024-00227.pdfvitamin dendocrinepolymorphisminsulin resistanceautoimmunity |
| spellingShingle | Nur Faten Hafizah Rosli Noor Shafina Mohd Nor Rose Adzrianee Adnan Siti Hamimah Sheikh Abdul Kadir A review of vitamin D deficiency and vitamin D receptor polymorphisms in endocrine-related disorders Clinical and Experimental Pediatrics vitamin d endocrine polymorphism insulin resistance autoimmunity |
| title | A review of vitamin D deficiency and vitamin D receptor polymorphisms in endocrine-related disorders |
| title_full | A review of vitamin D deficiency and vitamin D receptor polymorphisms in endocrine-related disorders |
| title_fullStr | A review of vitamin D deficiency and vitamin D receptor polymorphisms in endocrine-related disorders |
| title_full_unstemmed | A review of vitamin D deficiency and vitamin D receptor polymorphisms in endocrine-related disorders |
| title_short | A review of vitamin D deficiency and vitamin D receptor polymorphisms in endocrine-related disorders |
| title_sort | review of vitamin d deficiency and vitamin d receptor polymorphisms in endocrine related disorders |
| topic | vitamin d endocrine polymorphism insulin resistance autoimmunity |
| url | http://www.e-cep.org/upload/pdf/cep-2024-00227.pdf |
| work_keys_str_mv | AT nurfatenhafizahrosli areviewofvitaminddeficiencyandvitamindreceptorpolymorphismsinendocrinerelateddisorders AT noorshafinamohdnor areviewofvitaminddeficiencyandvitamindreceptorpolymorphismsinendocrinerelateddisorders AT roseadzrianeeadnan areviewofvitaminddeficiencyandvitamindreceptorpolymorphismsinendocrinerelateddisorders AT sitihamimahsheikhabdulkadir areviewofvitaminddeficiencyandvitamindreceptorpolymorphismsinendocrinerelateddisorders AT nurfatenhafizahrosli reviewofvitaminddeficiencyandvitamindreceptorpolymorphismsinendocrinerelateddisorders AT noorshafinamohdnor reviewofvitaminddeficiencyandvitamindreceptorpolymorphismsinendocrinerelateddisorders AT roseadzrianeeadnan reviewofvitaminddeficiencyandvitamindreceptorpolymorphismsinendocrinerelateddisorders AT sitihamimahsheikhabdulkadir reviewofvitaminddeficiencyandvitamindreceptorpolymorphismsinendocrinerelateddisorders |